CDS: Y39G8C.4
Y39G8C.4 | SMap | S_parent | Sequence | Y39G8C | |
---|---|---|---|---|---|
Structure | Source_exons | 1 | 262 | ||
1618 | 2150 | ||||
2776 | 3219 | ||||
DB_info | Database | TREMBL | Q7YTG4_CAEEL | ||
TrEMBL_AC | Q7YTG4 | ||||
NDB | GI_number | 33589170 | |||
Protein_id | Y39G8C | CAE45092 | 1 | ||
DB_remark | C. elegans COL-87 protein; contains similarity to Pfam domain PF01391 (Collagen triple helix repeat (20 copies))contains similarity to Interpro domain IPR008160 (Collagen triple helix repeat) | ||||
Origin | From_laboratory | HX | |||
Species | Caenorhabditis elegans | ||||
Properties | Coding | CDS | |||
Prediction_status | Predicted | ||||
Visible | Gene | Y39G8C.4 | |||
Corresponding_transcript | Y39G8C.4 | ||||
Corresponding_protein | WP:CE35195 | ||||
Corresponding_PCR_product | sjj_Y39G8C.c | ||||
mv_Y39G8C.c | |||||
Corresponding_RNAi_reagent | sjj_Y39G8C.c | ||||
RNAi_result | JA:Y39G8C.c | ||||
WB_RNAi_result | JA:Y39G8C.c | ||||
GO_term | GO:0006817 | IEA | Inferred_automatically | ||
GO:0005737 | IEA | Inferred_automatically | |||
Microarray_results | SMD_Y39G8C.C | ||||
Brief_identification | cuticular collagen | ||||
Remark | [030804 pad] Gene prediction added to represent col-87. Contains the signature GPRGVEGDPGIPGNKGGKGNNGNPGLDGYEGFPGPSGPEGEAGYDGEPGA. Needs verification. | Person_evidence | WBPerson651 | ||
Method | curated |