![Adult](JavaScript:void
window.open("/cgi-bin/rnaidb/popUpImage.cgi?imgName=N2wormfinal.png",
"RNAiDB Help","toolbar=no, location=no, directories=no,
status=no, menubar=no, scrollbars=yes, resizable=no,
copyhistory=no, width=1000, height=550"))
CDS: Y39G8C.4
| Y39G8C.4 | SMap | S_parent | Sequence | Y39G8C | |
|---|---|---|---|---|---|
| Structure | Source_exons | 1 | 262 | ||
| 1618 | 2150 | ||||
| 2776 | 3219 | ||||
| DB_info | Database | TREMBL | Q7YTG4_CAEEL | ||
| TrEMBL_AC | Q7YTG4 | ||||
| NDB | GI_number | 33589170 | |||
| Protein_id | Y39G8C | CAE45092 | 1 | ||
| DB_remark | C. elegans COL-87 protein; contains similarity to Pfam domain PF01391 (Collagen triple helix repeat (20 copies))contains similarity to Interpro domain IPR008160 (Collagen triple helix repeat) | ||||
| Origin | From_laboratory | HX | |||
| Species | Caenorhabditis elegans | ||||
| Properties | Coding (2) | ||||
| Visible | Gene | Y39G8C.4 | |||
| Corresponding_transcript | Y39G8C.4 | ||||
| Corresponding_protein | WP:CE35195 | ||||
| Corresponding_PCR_product | sjj_Y39G8C.c | ||||
| mv_Y39G8C.c | |||||
| Corresponding_RNAi_reagent | sjj_Y39G8C.c | ||||
| RNAi_result | JA:Y39G8C.c | ||||
| WB_RNAi_result | JA:Y39G8C.c | ||||
| GO_term | GO:0006817 | IEA | Inferred_automatically | ||
| GO:0005737 | IEA | Inferred_automatically | |||
| Microarray_results | SMD_Y39G8C.C | ||||
| Brief_identification | cuticular collagen | ||||
| Remark | [030804 pad] Gene prediction added to represent col-87. Contains the signature GPRGVEGDPGIPGNKGGKGNNGNPGLDGYEGFPGPSGPEGEAGYDGEPGA. Needs verification. | Person_evidence | WBPerson651 | ||
| Method | curated |
